Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYN Peptide - middle region

LYN Peptide - middle region

Product Specifications

Product Name Alternative

JTK8, p53Lyn, p56Lyn

UniProt

P07948

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001104567.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sp100 Nuclear Antigen (Sp100) ELISA Kit
201-12-4969 96 Tests

Human Sp100 Nuclear Antigen (Sp100) ELISA Kit

Sign In for Pricing
View Details
Human RNA polymerase II elongation factor ELL, ELL ELISA KIT
ELI-26107h 96 Tests

Human RNA polymerase II elongation factor ELL, ELL ELISA KIT

Sign In for Pricing
View Details
AmmTx3
AMX001-00100 0.1 mg

AmmTx3

Sign In for Pricing
View Details
Polyclonal Antibody to Cytokeratin 10 (CK10)
TRV-0042023-01 20 µL

Polyclonal Antibody to Cytokeratin 10 (CK10)

Sign In for Pricing
View Details
Polyclonal Antibody to Cytokeratin 10 (CK10)
TRV-0042023-02 100 µL

Polyclonal Antibody to Cytokeratin 10 (CK10)

Sign In for Pricing
View Details
Polyclonal Antibody to Cytokeratin 10 (CK10)
TRV-0042023-03 200 µL

Polyclonal Antibody to Cytokeratin 10 (CK10)

Sign In for Pricing
View Details