Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AmmTx3

AmmTx3 has been originally isolated from the venom of the scorpion Androctonus mauretanicus and is now offered by Smartox in its synthetic version. AmmTx3 binds on its target A-type potassium channel with an affinity of 66 pM in rat brain synaptosomes (Kv4 channels) . As such, AmmTx3 should represent an excellent tool to study action potential firing frequency, spike initiation and waveform in excitable cells. AmmTx3 was indeed found to block A-type potassium currents from cerebellum granular cells and from striatum neurons but with IC50 values of 130 nM. AmmTx3 appears to be a pore blocker of Kv4.2 and Kv4.3 and seems to require the expression of the Kv4 associated protein DPP6. It should also contribute to our understanding of learning, memory and behavior. AmmTx3 shares very high sequence homology with two other A-type potassium channel blockers, Aa1 from Androctonus australis (94%) and BmTx3 from Buthus martensi (91%), and according to binding experiments the same channel target as well. AmmTx3 is a member of the a-KTX 15 family of toxins and consist of a single chain of 37 amino acid residues, with an N-terminal pyroglutamate, cross-linked by three disulfide bridges.

Product Specifications

Specifications

Blocker of A-type potassium channels

Target

K channels

Sequence

IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP

Peptide Number

AMX001

Disulfide Bonds

Cys8-Cys28; Cys13-Cys33; Cys17-Cys35

N Terminal Sequence

PQ

C Terminal Sequence

OH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-STX1A Rabbit Monoclonal Antibody
M01961-3 100 μL/vial

Anti-STX1A Rabbit Monoclonal Antibody

Ask
View Details
Porcine A Disintegrin and Metalloprotease 18 ELISA Kit
MBS093523-01 48 Well

Porcine A Disintegrin and Metalloprotease 18 ELISA Kit

Ask
View Details
Porcine A Disintegrin and Metalloprotease 18 ELISA Kit
MBS093523-02 96 Well

Porcine A Disintegrin and Metalloprotease 18 ELISA Kit

Ask
View Details
Porcine A Disintegrin and Metalloprotease 18 ELISA Kit
MBS093523-03 5x 96 Well

Porcine A Disintegrin and Metalloprotease 18 ELISA Kit

Ask
View Details
Porcine A Disintegrin and Metalloprotease 18 ELISA Kit
MBS093523-04 10x 96 Well

Porcine A Disintegrin and Metalloprotease 18 ELISA Kit

Ask
View Details
Recombinant Human SIRPa protein, N-His Tag
IMP-2028 10 µg

Recombinant Human SIRPa protein, N-His Tag

Ask
View Details