Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYN Peptide - middle region

LYN Peptide - middle region

Product Specifications

Product Name Alternative

JTK8, p53Lyn, p56Lyn

UniProt

P07948

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001104567.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nickel Coated Microplates
20140020-2 20 Plates

Nickel Coated Microplates

Sign In for Pricing
View Details
rno-miR-139-5p miRNA Mimic
MBS8302652-01 5 nmol

rno-miR-139-5p miRNA Mimic

Sign In for Pricing
View Details
rno-miR-139-5p miRNA Mimic
MBS8302652-02 10 nmol

rno-miR-139-5p miRNA Mimic

Sign In for Pricing
View Details
rno-miR-139-5p miRNA Mimic
MBS8302652-03 5x 10 nmol

rno-miR-139-5p miRNA Mimic

Sign In for Pricing
View Details
CYP3A43 Antibody
63-328 400 µL

CYP3A43 Antibody

Sign In for Pricing
View Details
Vom1r48 CRISPRa sgRNA lentivector (set of three targets)(Rat)
50035126 3x 1.0µg DNA

Vom1r48 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details