Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD1 Peptide - middle region

RAD1 Peptide - middle region

Product Specifications

Product Name Alternative

REC1, HRAD1

UniProt

O60671

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002844.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNRPX (PLEKHJ1) Rabbit Polyclonal Antibody
TA366571 100 µL

GNRPX (PLEKHJ1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IP3 Receptor Recombinant Rabbit Monoclonal Antibody [JA11-35]
ET1704-77 100 µL

IP3 Receptor Recombinant Rabbit Monoclonal Antibody [JA11-35]

Sign In for Pricing
View Details
Mpzl1 (NM_001001880) Mouse Tagged ORF Clone
MG202237 10 µg

Mpzl1 (NM_001001880) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HUWE1 Polyclonal Antibody
E-AB-19540-01 20 µL

HUWE1 Polyclonal Antibody

Sign In for Pricing
View Details
HUWE1 Polyclonal Antibody
E-AB-19540-02 60 µL

HUWE1 Polyclonal Antibody

Sign In for Pricing
View Details
HUWE1 Polyclonal Antibody
E-AB-19540-03 120 µL

HUWE1 Polyclonal Antibody

Sign In for Pricing
View Details