C1QBP Peptide - middle region
C1QBP Peptide - middle region
Product Specifications
Product Name Alternative
P32, HABP1, gC1qR, GC1QBP, SF2p32, gC1Q-R
UniProt
Q07021
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001203.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15248922 1 Vial
Lentiviral mouse Sec23b shRNA (UAS) - Lentiviral mouse Sec23b shRNA (UAS) (100)
Sign In for Pricing
View Details 
44351111 3x 1.0 µg
SLFN12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
BML-PW0605-0025 25 µg
Polyubiquitin (K63-linkage-specific) monoclonal antibody (HWA4C4) (HRP conjugate)
Sign In for Pricing
View Details