Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFC2 Peptide - middle region

RFC2 Peptide - middle region

Product Specifications

Product Name Alternative

RFC40

UniProt

P35250

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265720.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD89 antibody
STJ16100533 100 µg

Anti-CD89 antibody

Sign In for Pricing
View Details
EGFR-IN-22
HY-142679 1 Each

EGFR-IN-22

Sign In for Pricing
View Details
Afurolol hydrochloride, (R)-
MBS5810913 Inquire

Afurolol hydrochloride, (R)-

Sign In for Pricing
View Details
SPIN3 (NM_001010862) Human Tagged ORF Clone
RC215063 10 µg

SPIN3 (NM_001010862) Human Tagged ORF Clone

Sign In for Pricing
View Details
CEACAM6 Blocking Peptide
33R-4544 100 ug

CEACAM6 Blocking Peptide

Sign In for Pricing
View Details
Mouse Adgra3 Pre-designed siRNA Set A
SI100298A 1 Each

Mouse Adgra3 Pre-designed siRNA Set A

Sign In for Pricing
View Details