Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA7 Peptide - middle region

UBA7 Peptide - middle region

Product Specifications

Product Name Alternative

D8, UBE2, UBA1B, UBE1L

UniProt

P41226

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003326.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2 (SMP14), 0.2mg/mL
BNUB1721-100 1x 100 µL

MDM2 (SMP14), 0.2mg/mL

Sign In for Pricing
View Details
FITC Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163C-01 20 Tests

FITC Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
FITC Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163C-02 100 Tests

FITC Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
FITC Anti-Human CD326/EpCAM Antibody[9C4]
E-AB-F1163C-03 2x 100 Tests

FITC Anti-Human CD326/EpCAM Antibody[9C4]

Sign In for Pricing
View Details
Dopamine Transporter Recombinant Chimeric Antibody Antibody
HA610244 100 µg

Dopamine Transporter Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Sodium Trimetaphosphate
TRC-S673780-50G 50 g

Sodium Trimetaphosphate

Sign In for Pricing
View Details