Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REPS2 Peptide - middle region

REPS2 Peptide - middle region

Product Specifications

Product Name Alternative

POB1

UniProt

Q8NFH8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074444.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP-1/NF-κB activation inhibitor 1
orb1685254-01 1 mg

AP-1/NF-κB activation inhibitor 1

Sign In for Pricing
View Details
AP-1/NF-κB activation inhibitor 1
orb1685254-02 2 mg

AP-1/NF-κB activation inhibitor 1

Sign In for Pricing
View Details
AP-1/NF-κB activation inhibitor 1
orb1685254-03 5 mg

AP-1/NF-κB activation inhibitor 1

Sign In for Pricing
View Details
AP-1/NF-κB activation inhibitor 1
orb1685254-04 1 ml x 10 mM (in DMSO)

AP-1/NF-κB activation inhibitor 1

Sign In for Pricing
View Details
AP-1/NF-κB activation inhibitor 1
orb1685254-05 10 mg

AP-1/NF-κB activation inhibitor 1

Sign In for Pricing
View Details
AP-1/NF-κB activation inhibitor 1
orb1685254-06 25 mg

AP-1/NF-κB activation inhibitor 1

Sign In for Pricing
View Details