Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK6 Peptide - middle region

CDK6 Peptide - middle region

Product Specifications

Product Name Alternative

MCPH12, PLSTIRE

UniProt

Q00534

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138778.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)
orb2932655-01 20 µg

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)

Sign In for Pricing
View Details
Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)
orb2932655-02 100 µg

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)

Sign In for Pricing
View Details
LOC642204 ORF Vector (Human) (pORF)
ORF013673 1.0 µg DNA

LOC642204 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rat Antithrombin (AT) ELISA Kit
MBS2024778-01 24 Strip Well

Rat Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details
Rat Antithrombin (AT) ELISA Kit
MBS2024778-02 48 Well

Rat Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details
Rat Antithrombin (AT) ELISA Kit
MBS2024778-03 96 Well

Rat Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details