Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)

This Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Uncharacterized protein 169L

UniProt

O55762

Expression Region

1-132

Origin

Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSNISNQKLVLFFTIILIALCPFVYYLWDNEILGIGNWGRKRKDTFEDKNCSTEIEHAI EEHKRKNKEKKEAKEKRLAPGRVKISTYDVNNENYLLGDVNDELQPNIPGYLTKETAYPF DCEPDDRSNRWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-100 1x 100 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-100 1x 100 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (IVRN/827), CF680 conjugate, 0.1mg/mL
BNC800827-100 1x 100 µL

Involucrin (IVRN/827), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details