What is the catalog number for GNA12 Peptide - middle region?

The catalog number for GNA12 Peptide - middle region is orb1998667.

What sizes are available for GNA12 Peptide - middle region?

GNA12 Peptide - middle region is available in the following size(s): 100 µg.

Is GNA12 Peptide - middle region in stock?

GNA12 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GNA12 Peptide - middle region

Product Specifications

Product Name Alternative

RMP, gep, NNX3

UniProt

Q03113

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269370.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HY-149997 1 Each

Anticancer agent 120

Sign In for Pricing

View Details

CF807575 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]

Sign In for Pricing

View Details

bs-2803R-PE 100 µL

TNFAIP3 Polyclonal Antibody, PE Conjugated

Sign In for Pricing

View Details

035133-HRP 200 µL

EPS8L1, NT (EPS8L1, DRC3, EPS8R1, Epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1) (Azide free) (HRP) discontinued

Sign In for Pricing

View Details

S3627-1g 1 g

Tryptamine

Sign In for Pricing

View Details

S4854-5mg 5 mg

Bedaquiline fumarate

Sign In for Pricing

View Details