Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4A Peptide - middle region

PLA2G4A Peptide - middle region

Product Specifications

Product Name Alternative

CPLA2, PLA2G4, cPLA2-alpha

UniProt

P47712

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001298122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cow Interleukin 10 (IL10) CLIA Kit
abx490840-01 96 Tests

Cow Interleukin 10 (IL10) CLIA Kit

Sign In for Pricing
View Details
Cow Interleukin 10 (IL10) CLIA Kit
abx490840-02 5x 96 Tests

Cow Interleukin 10 (IL10) CLIA Kit

Sign In for Pricing
View Details
Cow Interleukin 10 (IL10) CLIA Kit
abx490840-03 10x 96 Tests

Cow Interleukin 10 (IL10) CLIA Kit

Sign In for Pricing
View Details
(S, S) -BMS-984923
HY-141848A 5 mg

(S, S) -BMS-984923

Sign In for Pricing
View Details
Recombinant Human ZCCHC10 Protein
E30P9513 20 µg

Recombinant Human ZCCHC10 Protein

Sign In for Pricing
View Details
Lentiviral mouse Slfn9 shRNA (UAS) - Lentiviral mouse Slfn9 shRNA (UAS, iRFP) (100)
GTR15297126 1 Vial

Lentiviral mouse Slfn9 shRNA (UAS) - Lentiviral mouse Slfn9 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details