Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRCC4 Peptide - middle region

XRCC4 Peptide - middle region

Product Specifications

Product Name Alternative

SSMED

UniProt

Q13426

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001304941.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpp14 Mouse Gene Knockout Kit (CRISPR)
KN515065 1 Kit

Rpp14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Matriptase 2 Antibody / TMPRSS6
RQ7108 100 µg

Matriptase 2 Antibody / TMPRSS6

Sign In for Pricing
View Details
Recombinant Human Interleukin-13/IL-13 Protein (Fc Tag)
PKSH032457-01 50 µg

Recombinant Human Interleukin-13/IL-13 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Interleukin-13/IL-13 Protein (Fc Tag)
PKSH032457-02 500 µg

Recombinant Human Interleukin-13/IL-13 Protein (Fc Tag)

Sign In for Pricing
View Details
TEX261 Human Gene Knockout Kit (CRISPR)
KN418357 1 Kit

TEX261 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BMPR1A (N-term) Rabbit Polyclonal Antibody
AP11857PU-N 400 µL

BMPR1A (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details