What is the catalog number for SOX13 Peptide - middle region?

The catalog number for SOX13 Peptide - middle region is orb1998613.

What sizes are available for SOX13 Peptide - middle region?

SOX13 Peptide - middle region is available in the following size(s): 100 µg.

Is SOX13 Peptide - middle region in stock?

SOX13 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SOX13 Peptide - middle region

Product Specifications

Product Name Alternative

ICA12, Sox-13

UniProt

P35711

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005677.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCIVEGKRLRVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

334431-01 50 µg

SLC13A4 (FITC)

Sign In for Pricing

View Details

334431-02 100 µg

SLC13A4 (FITC)

Sign In for Pricing

View Details

ARP40344_P050-Biotin 100 µL

BFSP1 Antibody - N-terminal region : Biotin (ARP40344_P050-Biotin)

Sign In for Pricing

View Details

NBP2-71339AF350 0.1 mL

Mouse Monoclonal BTG2 Antibody (OTI4C10) [Alexa Fluor 350]

Sign In for Pricing

View Details

BNCB0954-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), Biotin conjugate, 0.1mg/mL

Sign In for Pricing

View Details

orb1999867 100 µg

UBE2D3 Peptide - C-terminal region

Sign In for Pricing

View Details