Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D3 Peptide - C-terminal region

UBE2D3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UBC4/5, UBCH5C, E2 (17) KB3

UniProt

P61077

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003331.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -2- (Methoxymethyl) pyrrolidine hydrochloride
WEA81772 5 g

(R) -2- (Methoxymethyl) pyrrolidine hydrochloride

Sign In for Pricing
View Details
Rabbit anti-LEPREL1 Antibody
YLD4692-01 50 µL

Rabbit anti-LEPREL1 Antibody

Sign In for Pricing
View Details
Rabbit anti-LEPREL1 Antibody
YLD4692-02 100 µL

Rabbit anti-LEPREL1 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Complement C4d Antibody (C4D/9213R) [Alexa Fluor 350]
NBP3-24022AF350 0.1 mL

Rabbit Monoclonal Complement C4d Antibody (C4D/9213R) [Alexa Fluor 350]

Sign In for Pricing
View Details
Phospho-Histone H2B (Ser14) Rabbit pAb
E2370343 100 µL

Phospho-Histone H2B (Ser14) Rabbit pAb

Sign In for Pricing
View Details
TTYH3 3'UTR GFP Stable Cell Line
TU077502 1.0 mL

TTYH3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details