Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBNA1BP2 Peptide - middle region

EBNA1BP2 Peptide - middle region

Product Specifications

Product Name Alternative

P40, EBP2, NOBP

UniProt

Q99848

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153408.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGRGLKRPGKKGSNKRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBcAg Recombinant Protein
OPCA02854-100UG 100 µg

HBcAg Recombinant Protein

Sign In for Pricing
View Details
Ketanserin tartrate
SIH-618-5MG 5 mg

Ketanserin tartrate

Sign In for Pricing
View Details
ICK Antibody
OASG03928-100UL 100 µL

ICK Antibody

Sign In for Pricing
View Details
IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) Antibody
orb1713011 0.1 mL

IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) Antibody

Sign In for Pricing
View Details
DPY19L1P2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0630104 1.0 µg DNA

DPY19L1P2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
KLHDC4 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV711710 1.0 µg DNA

KLHDC4 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details