Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP10 Peptide - middle region

DUSP10 Peptide - middle region

Product Specifications

Product Name Alternative

MKP5, MKP-5

UniProt

Q9Y6W6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009138.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti CTH Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 120ul
IRBAMLCTHAP819120UL 120 µL

Rabbit Anti CTH Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot) 120ul

Sign In for Pricing
View Details
PLGF, Mouse (HEK293, His)
HY-P70792-01 2 µg

PLGF, Mouse (HEK293, His)

Sign In for Pricing
View Details
PLGF, Mouse (HEK293, His)
HY-P70792-02 10 µg

PLGF, Mouse (HEK293, His)

Sign In for Pricing
View Details
PLGF, Mouse (HEK293, His)
HY-P70792-03 50 µg

PLGF, Mouse (HEK293, His)

Sign In for Pricing
View Details
PLGF, Mouse (HEK293, His)
HY-P70792-04 100 µg

PLGF, Mouse (HEK293, His)

Sign In for Pricing
View Details
Anti-Human EPHX2 Nanobody (SAA1372)
HW838013-01 50 µg

Anti-Human EPHX2 Nanobody (SAA1372)

Sign In for Pricing
View Details