PLGF, Mouse (HEK293, His)
PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
PLGF Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/plgf-protein-mouse-hek-293-his.html
Purity
95.0
Smiles
VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
Molecular Formula
18654 (Gene_ID) P49764 (V19-P158) (Accession)
Molecular Weight
Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), CF488A conjugate, 0.1mg/mL
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), Biotin conjugate, 0.1mg/mL
Calponin-1 (Smooth Muscle Marker) (rCNN1/832), CF640R conjugate, 0.1mg/mL
