Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITPKA Peptide - C-terminal region

ITPKA Peptide - C-terminal region

Product Specifications

Product Name Alternative

IP3KA, IP3-3KA

UniProt

P23677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002211.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVWLIDFGKTTPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNAL1 Antibody - N-terminal region
ARP82255_P050-25UL 25 µL

CTNNAL1 Antibody - N-terminal region

Sign In for Pricing
View Details
LRFN4 Peptide - C-terminal region
orb2001110 100 µg

LRFN4 Peptide - C-terminal region

Sign In for Pricing
View Details
ZEB2P1 AAV Vector (Human) (CMV)
50815101 1 µg

ZEB2P1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Cavy Glutamic Acid Decarboxylase Antibody ELISA Kit
MBS021958 Inquire

Cavy Glutamic Acid Decarboxylase Antibody ELISA Kit

Sign In for Pricing
View Details
Stat2 (B-3) Alexa Fluor® 488
sc-514193 AF488 200 µg/mL

Stat2 (B-3) Alexa Fluor® 488

Sign In for Pricing
View Details
Rabbit Polyclonal HMGB1/HMG-1 Antibody [mFluor Violet 610 SE]
NB100-2322MFV610 0.1 mL

Rabbit Polyclonal HMGB1/HMG-1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details