Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRFN4 Peptide - C-terminal region

LRFN4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SALM3, SALM3., FIGLER6

UniProt

Q6PJG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRFN4 Rabbit Polyclonal Antibody (orb589130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076941.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRLGGAW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D17H6S53E AAV siRNA Pooled Vector
17577164 1.0 µg

D17H6S53E AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CLDN1 Protein Vector (Human) (pPM-C-His)
PV009636 500 ng

CLDN1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CCBL1 (KYAT1) (NM_004059) Human Tagged Lenti ORF Clone
RC216317L3 10 µg

CCBL1 (KYAT1) (NM_004059) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PC2 HDR Plasmid (m)
sc-422140-HDR 20 µg

PC2 HDR Plasmid (m)

Sign In for Pricing
View Details
Rabbit Anti-LYZL2 antibody
SL18594R-01 50 µL

Rabbit Anti-LYZL2 antibody

Sign In for Pricing
View Details
Rabbit Anti-LYZL2 antibody
SL18594R-02 100 µL

Rabbit Anti-LYZL2 antibody

Sign In for Pricing
View Details