What is the catalog number for ST8SIA1 Peptide - middle region?

The catalog number for ST8SIA1 Peptide - middle region is orb1998483.

What sizes are available for ST8SIA1 Peptide - middle region?

ST8SIA1 Peptide - middle region is available in the following size(s): 100 µg.

Is ST8SIA1 Peptide - middle region in stock?

ST8SIA1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ST8SIA1 Peptide - middle region

Product Specifications

Product Name Alternative

GD3S, SIAT8, SIAT8A, SIAT8-A, ST8SiaI

UniProt

Q92185

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001291379.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ES2070-01 50 µL

CTPS rabbit pAb

Sign In for Pricing

View Details

ES2070-02 100 µL

CTPS rabbit pAb

Sign In for Pricing

View Details

19302051 1.0 mL

ENOSF1 Adenovirus (Human)

Sign In for Pricing

View Details

C266-500ug 500 µg

Recombinant Human Chloride Intracellular Channel Protein 2/CLIC2 (N-6His)

Sign In for Pricing

View Details

bs-13731R-HRP 100 µL

PCDH21 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing

View Details

VAng-Wyb3459-100gEcoli 100 µg (E. coli)

Recombinant JEV NS4A (aa 2124–2412) [His] Protein (strain SA-14)

Sign In for Pricing

View Details