Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA2 Peptide - C-terminal region

PDIA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDI, PDA2, PDIP, PDIR

UniProt

Q13087

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006840.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD45RA Recombinant Mouse monoclonal Antibody
HA601525F 100 Tests

Human CD45RA Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
5- (&6) -Carboxy-2', 7'-Dichlorofluorescein
#51016 1x 100 mg

5- (&6) -Carboxy-2', 7'-Dichlorofluorescein

Sign In for Pricing
View Details
Human C5a (Complement Component 5a) CLIA Kit
E-CL-H0174-01 24 Tests

Human C5a (Complement Component 5a) CLIA Kit

Sign In for Pricing
View Details
Human C5a (Complement Component 5a) CLIA Kit
E-CL-H0174-02 48 Tests

Human C5a (Complement Component 5a) CLIA Kit

Sign In for Pricing
View Details
Human C5a (Complement Component 5a) CLIA Kit
E-CL-H0174-03 96 Tests

Human C5a (Complement Component 5a) CLIA Kit

Sign In for Pricing
View Details
Muscle Specific Actin (MSA/953), CF740 conjugate, 0.1mg/mL
BNC740953-500 1x 500 µL

Muscle Specific Actin (MSA/953), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details