Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRS2 Peptide - middle region

FRS2 Peptide - middle region

Product Specifications

Product Name Alternative

SNT, SNT1, FRS1A, FRS2A, SNT-1, FRS2alpha

UniProt

Q8WU20

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036020.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hnRNP F (HNRNPF) (NM_001098204) Human Recombinant Protein
TP312850L 1 mg

hnRNP F (HNRNPF) (NM_001098204) Human Recombinant Protein

Sign In for Pricing
View Details
ROR1 (NM_005012) Human Recombinant Protein
TP314967 20 µg

ROR1 (NM_005012) Human Recombinant Protein

Sign In for Pricing
View Details
Fumonisin B1
SIH-234-1MG 1 mg

Fumonisin B1

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR562649 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Grin2a (C-term) Rabbit Polyclonal Antibody
AP26445PU-N 100 µL

Grin2a (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NSUN3 Recombinant Rabbit Monoclonal Antibody [PSH01-97]
HA721755 100 µL

NSUN3 Recombinant Rabbit Monoclonal Antibody [PSH01-97]

Sign In for Pricing
View Details