Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX20 Peptide - middle region

DDX20 Peptide - middle region

Product Specifications

Product Name Alternative

DP103, GEMIN3

UniProt

Q9UHI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009135.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEQPPNGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR562237 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
CYTO-13 *5 mM DMSO solution*
17553-AAT 0.5 mL

CYTO-13 *5 mM DMSO solution*

Sign In for Pricing
View Details
Cyclohexyl-1-cyclohexenyl Ketone
TRC-C988027-2.5G 2.5 g

Cyclohexyl-1-cyclohexenyl Ketone

Sign In for Pricing
View Details
B7-1/CD80 Polyclonal Antibody
AN005820L-01 25 µL

B7-1/CD80 Polyclonal Antibody

Sign In for Pricing
View Details
B7-1/CD80 Polyclonal Antibody
AN005820L-02 100 µL

B7-1/CD80 Polyclonal Antibody

Sign In for Pricing
View Details
Human FAM76A activation kit by CRISPRa
GA116322 1 Kit

Human FAM76A activation kit by CRISPRa

Sign In for Pricing
View Details