Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO5 Peptide - middle region

IPO5 Peptide - middle region

Product Specifications

Product Name Alternative

IMB3, Pse1, imp5, KPNB3, RANBP5

UniProt

O00410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002262.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S6K1 (RPS6KB1) Human Gene Knockout Kit (CRISPR)
KN217324 1 Kit

S6K1 (RPS6KB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Blood Group H Type 2 (CD173) (19-OLE), 0.2mg/mL
BNUB0947-100 1x 100 µL

Blood Group H Type 2 (CD173) (19-OLE), 0.2mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), Biotin conjugate, 0.1mg/mL
BNCB2136-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PNMA8B Human Gene Knockout Kit (CRISPR)
KN213508LP 1 Kit

PNMA8B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Bromo-1-(triisopropylsilyl)pyrrole
TRC-B699075-500MG 500 mg

3-Bromo-1-(triisopropylsilyl)pyrrole

Sign In for Pricing
View Details
Anti-CK18
Y123081 100 µL

Anti-CK18

Sign In for Pricing
View Details