Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFR476 Peptide - C-terminal region

OLFR476 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MOR204-3

UniProt

Q8VGI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_667135.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEALRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen,  30nm
GM-47-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Surface Antigen, 30nm

Sign In for Pricing
View Details
3-Hydroxyphthalic Anhydride
TRC-H951270-2.5G 2.5 g

3-Hydroxyphthalic Anhydride

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS803219 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Heptaethylene Glycol Monododecyl Ether
TRC-H280285-1G 1 g

Heptaethylene Glycol Monododecyl Ether

Sign In for Pricing
View Details
B-AP15
SIH-339-5MG 5 mg

B-AP15

Sign In for Pricing
View Details
CTSV Antibody
KC-29363-01 50 μL

CTSV Antibody

Sign In for Pricing
View Details