Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENDOD1 Peptide - middle region

ENDOD1 Peptide - middle region

Product Specifications

UniProt

O94919

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055851.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KMKKILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSTM2A antibody
70R-5328 100 µL

VSTM2A antibody

Sign In for Pricing
View Details
8-iso Prostaglandin E2
T36160-01 500 µg

8-iso Prostaglandin E2

Sign In for Pricing
View Details
8-iso Prostaglandin E2
T36160-02 1 mg

8-iso Prostaglandin E2

Sign In for Pricing
View Details
8-iso Prostaglandin E2
T36160-03 5 mg

8-iso Prostaglandin E2

Sign In for Pricing
View Details
8-iso Prostaglandin E2
T36160-04 10 mg

8-iso Prostaglandin E2

Sign In for Pricing
View Details
Lentiviral human KLRB1 shRNA (UAS) - Lentiviral human KLRB1 shRNA (UAS) (100)
GTR15087882 1 Vial

Lentiviral human KLRB1 shRNA (UAS) - Lentiviral human KLRB1 shRNA (UAS) (100)

Sign In for Pricing
View Details