Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSCB Peptide - middle region

FSCB Peptide - middle region

Product Specifications

UniProt

Q4V7A4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSQQTSCTGDWSLIYICPKEKVDKEQQTYFSELEIIIRSIPGSSMTKSKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V5 tag, AlpHcAbs® Rabbit
HA710017 100 µg

V5 tag, AlpHcAbs® Rabbit

Sign In for Pricing
View Details
Frozen Tissue Sections, Adrenal gland
CS644735 5x 5 µm

Frozen Tissue Sections, Adrenal gland

Sign In for Pricing
View Details
DDX58 Rabbit Polyclonal Antibody
TA371671 100 µL

DDX58 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PARP-1 Protein (His Tag)
PKSH031294 50 µg

Recombinant Human PARP-1 Protein (His Tag)

Sign In for Pricing
View Details
Phenylmercuric Chloride
TRC-P335658-5G 5 g

Phenylmercuric Chloride

Sign In for Pricing
View Details
2-Chloroimidazo[1,2-a]pyridine-6-carbonitrile
TRC-C382930-5MG 5 mg

2-Chloroimidazo[1,2-a]pyridine-6-carbonitrile

Sign In for Pricing
View Details