Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRMD8 Peptide - middle region

FRMD8 Peptide - middle region

Product Specifications

Product Name Alternative

AU018809, 1200004M23Rik, 2310035N23Rik, 4931429L16Rik

UniProt

Q3UFK8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080445.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAVREVLQLPDVALEAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RPL5 protein
orb245133-01 20 µg

Human RPL5 protein

Sign In for Pricing
View Details
Human RPL5 protein
orb245133-02 100 µg

Human RPL5 protein

Sign In for Pricing
View Details
Human RPL5 protein
orb245133-03 1 mg

Human RPL5 protein

Sign In for Pricing
View Details
SIPA1L1 Rabbit Polyclonal Antibody (Cy5)
orb950313 100 µL

SIPA1L1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)
orb3009146-01 20 µg

Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)

Sign In for Pricing
View Details
Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)
orb3009146-02 100 µg

Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)

Sign In for Pricing
View Details