Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)

This Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B) spans the amino acid sequence from region 1-209. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CDRT15P3 CDRT15P3 C2orf27B

UniProt

P0DPF6

Expression Region

1-209

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PyOxim
TRC-P999410-2.5G 2.5 g

PyOxim

Sign In for Pricing
View Details
Celf4 Mouse Gene Knockout Kit (CRISPR)
KN503116 1 Kit

Celf4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Midkine (MDK) (NM_001012334) Human Over-expression Lysate
LY425316 100 µg

Midkine (MDK) (NM_001012334) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS626004 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Lin28a (NM_145833) Mouse Tagged ORF Clone
MG202250 10 µg

Lin28a (NM_145833) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF740 conjugate, 0.1mg/mL
BNC742250-500 1x 500 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details