Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14 Peptide - C-terminal region

USP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TGT

UniProt

P54578

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPF ELISA Kit (Human) : 96 Wells (OKEH00305)
OKEH00305 96 Well

LIPF ELISA Kit (Human) : 96 Wells (OKEH00305)

Sign In for Pricing
View Details
Dihexyl phthalate-3,4,5,6-d4
HY-W011215S-01 5 mg

Dihexyl phthalate-3,4,5,6-d4

Sign In for Pricing
View Details
Dihexyl phthalate-3,4,5,6-d4
HY-W011215S-02 10 mg

Dihexyl phthalate-3,4,5,6-d4

Sign In for Pricing
View Details
Rabbit Polyclonal MBNL3 Antibody
NBP1-32575 0.1 mL

Rabbit Polyclonal MBNL3 Antibody

Sign In for Pricing
View Details
RNF167 CRISPRa sgRNA lentivector (set of three targets)(Human)
40266121 3x 1.0µg DNA

RNF167 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Rickettsia africae Acyl carrier protein (acpP)
MBS1034912-01 0.02 mg (E-Coli)

Recombinant Rickettsia africae Acyl carrier protein (acpP)

Sign In for Pricing
View Details