Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS15 Peptide - C-terminal region

EPS15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AF1P, AF-1P, MLLT5

UniProt

P42566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153441.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK beta Antibody
F40421-0.4ML 0.4 mL

IKK beta Antibody

Sign In for Pricing
View Details
GPBAR1 Human shRNA Plasmid Kit (Locus ID 151306)
TL304276 1 Kit

GPBAR1 Human shRNA Plasmid Kit (Locus ID 151306)

Sign In for Pricing
View Details
LRRC71 Adenovirus (Rat)
27698056 1.0 mL

LRRC71 Adenovirus (Rat)

Sign In for Pricing
View Details
MCAM (Cell Surface Glycoprotein MUC18, Melanoma-associated Antigen MUC18, Melanoma Cell Adhesion Molecule, Melanoma-associated Antigen A32, S-endo 1 Endothelial-associated Antigen, Cell Surface Glycoprotein P1H12, CD146, MCAM, MUC18)
129475 50 µg

MCAM (Cell Surface Glycoprotein MUC18, Melanoma-associated Antigen MUC18, Melanoma Cell Adhesion Molecule, Melanoma-associated Antigen A32, S-endo 1 Endothelial-associated Antigen, Cell Surface Glycoprotein P1H12, CD146, MCAM, MUC18)

Sign In for Pricing
View Details
Pak4 Antibody
F43855-0.4ML 0.4 mL

Pak4 Antibody

Sign In for Pricing
View Details
DOCK5 Antibody
A68843-50UG 50 µg

DOCK5 Antibody

Sign In for Pricing
View Details