Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSL Peptide - middle region

CTSL Peptide - middle region

Product Specifications

Product Name Alternative

MEP, CATL, CTSL1

UniProt

P07711

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001244900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNA polymerase-IN-2
HY-163016 1 Each

RNA polymerase-IN-2

Sign In for Pricing
View Details
Human Histone H1t (HIST1H1T) ELISA Kit
MBS7214922-01 48 Well

Human Histone H1t (HIST1H1T) ELISA Kit

Sign In for Pricing
View Details
Human Histone H1t (HIST1H1T) ELISA Kit
MBS7214922-02 96 Well

Human Histone H1t (HIST1H1T) ELISA Kit

Sign In for Pricing
View Details
Human Histone H1t (HIST1H1T) ELISA Kit
MBS7214922-03 5x 96 Well

Human Histone H1t (HIST1H1T) ELISA Kit

Sign In for Pricing
View Details
Human Histone H1t (HIST1H1T) ELISA Kit
MBS7214922-04 10x 96 Well

Human Histone H1t (HIST1H1T) ELISA Kit

Sign In for Pricing
View Details
Rat Ifnar1 Pre-designed siRNA Set B
SI206565B 1 Each

Rat Ifnar1 Pre-designed siRNA Set B

Sign In for Pricing
View Details