Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD3 Peptide - N-terminal region

SMAD3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436

UniProt

P84022

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138574.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR560096 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
HAUS4 (NM_001166269) Human Over-expression Lysate
LY432946 100 µg

HAUS4 (NM_001166269) Human Over-expression Lysate

Sign In for Pricing
View Details
NucSpot® 568/580, 1000X in DMSO
#41036 1x 100 µL

NucSpot® 568/580, 1000X in DMSO

Sign In for Pricing
View Details
CD206 antibody
FNab09812 100 µg

CD206 antibody

Sign In for Pricing
View Details
Mouse Olfr16 activation kit by CRISPRa
GA203016 1 Kit

Mouse Olfr16 activation kit by CRISPRa

Sign In for Pricing
View Details
EDG6 (S1PR4) (NM_003775) Human Over-expression Lysate
LC401243 20 µg

EDG6 (S1PR4) (NM_003775) Human Over-expression Lysate

Sign In for Pricing
View Details