Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUTA Peptide - middle region

CUTA Peptide - middle region

Product Specifications

Product Name Alternative

AI326454, 0610039D01Rik, 1810022E02Rik, 1810060C03Rik, 2700094G22Rik

UniProt

Q9CQ89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080583.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTEFVRSVHPYEVAEVIALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEAD ligand 1
HY-158400 1 Each

TEAD ligand 1

Sign In for Pricing
View Details
Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit
MBS731257-01 48 Well

Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit
MBS731257-02 96 Well

Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit
MBS731257-03 5x 96 Well

Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit
MBS731257-04 10x 96 Well

Guinea pig Pancreatic carcinoma marker-CA242 ELISA Kit

Sign In for Pricing
View Details
Recombinant Midline 1 (MID1)
TRV-0015150-01 10 µg

Recombinant Midline 1 (MID1)

Sign In for Pricing
View Details