Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFN2 Peptide - middle region

MFN2 Peptide - middle region

Product Specifications

Product Name Alternative

Fzo, D630023P19Rik

UniProt

Q80U63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272849.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMV-p65 (CMV100), CF488A conjugate, 0.1mg/mL
BNC880100-500 1x 500 µL

CMV-p65 (CMV100), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LRRC75A Antibody (Biotin)
KB-3139-01 50 μL

LRRC75A Antibody (Biotin)

Sign In for Pricing
View Details
LRRC75A Antibody (Biotin)
KB-3139-02 100 µL

LRRC75A Antibody (Biotin)

Sign In for Pricing
View Details
LRRC75A Antibody (Biotin)
KB-3139-03 1 mL

LRRC75A Antibody (Biotin)

Sign In for Pricing
View Details
MAGI3 (NM_152900) Human Recombinant Protein
TP318925M 100 µg

MAGI3 (NM_152900) Human Recombinant Protein

Sign In for Pricing
View Details
BMP2 Polyclonal Antibody
E-AB-70111-01 60 µL

BMP2 Polyclonal Antibody

Sign In for Pricing
View Details