Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL30 Peptide - C-terminal region

RPL30 Peptide - C-terminal region

Product Specifications

UniProt

P62889

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001156957.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD172a (P84) In Vivo Antibody - Low Endotoxin
ICH1076-100mg 100 mg

Anti-Mouse CD172a (P84) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB503631 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Cst6 (NM_028623) Mouse Tagged ORF Clone
MG201045 10 µg

Cst6 (NM_028623) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL
BNC880296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wsb2 Mouse Gene Knockout Kit (CRISPR)
KN519469 1 Kit

Wsb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DO Meter BMET-403
BMET-403 1 Unit

DO Meter BMET-403

Sign In for Pricing
View Details