What is the catalog number for CRB3 Peptide - middle region?

The catalog number for CRB3 Peptide - middle region is orb1997746.

What sizes are available for CRB3 Peptide - middle region?

CRB3 Peptide - middle region is available in the following size(s): 100 µg.

Is CRB3 Peptide - middle region in stock?

CRB3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CRB3 Peptide - middle region

Product Specifications

Product Name Alternative

AU015179, AU041752, 5730439B18

UniProt

Q8QZT4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_808306.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGGLSSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb772144-01 50 μL

ALKB7 rabbit pAb Antibody

Sign In for Pricing

View Details

orb772144-02 100 µL

ALKB7 rabbit pAb Antibody

Sign In for Pricing

View Details

FAB5048G 0.1 mL

Mouse Monoclonal CD63 Antibody (460305) [Alexa Fluor 488]

Sign In for Pricing

View Details

A05467-1-APC 100 µg/Vial

Anti-SLC44A2 Antibody Picoband®, APC Conjugate

Sign In for Pricing

View Details

PH38089M5 20 µg

SEC63 (NM_007214) Human Recombinant Protein

Sign In for Pricing

View Details

TNU1579-01 10 mg

5-O-t-Butyldiphenyl silyl-2,3-O-isopropylidene-D-ribono-1,4-lactone

Sign In for Pricing

View Details