Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAP31 Peptide - C-terminal region

BCAP31 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDM, DDCH, BAP31, 6C6-AG, DXS1357E

UniProt

P51572

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001132913.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Zic3 protein (His tag)
PDEH100975-01 20 µg

Recombinant Human Zic3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Zic3 protein (His tag)
PDEH100975-02 100 µg

Recombinant Human Zic3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Zic3 protein (His tag)
PDEH100975-03 500 µg

Recombinant Human Zic3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Zic3 protein (His tag)
PDEH100975-04 1 mg

Recombinant Human Zic3 protein (His tag)

Sign In for Pricing
View Details
USP8 (NM_005154) Human Recombinant Protein
TP316926 20 µg

USP8 (NM_005154) Human Recombinant Protein

Sign In for Pricing
View Details
DEPDC5 Human Gene Knockout Kit (CRISPR)
KN211462BN 1 Kit

DEPDC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details