Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF1 Peptide - C-terminal region

KLF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

9830124P08Rik

UniProt

Q99JB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAHLRTHTGEKPYACSWDGCDWRFARSDELTRHYRKHTGHRPFCCGLCPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quassin (~90%)
TRC-Q509403-2.5MG 2.5 mg

Quassin (~90%)

Sign In for Pricing
View Details
Recombinant Mouse IL-1A/IL-1α Protein
PKSM041080-01 20 µg

Recombinant Mouse IL-1A/IL-1α Protein

Sign In for Pricing
View Details
Recombinant Mouse IL-1A/IL-1α Protein
PKSM041080-02 100 µg

Recombinant Mouse IL-1A/IL-1α Protein

Sign In for Pricing
View Details
Tissue Protein Lysate, Jejunum
CP565473 150 µg

Tissue Protein Lysate, Jejunum

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), 1mg/mL
BNUM3093-50 1x 50 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), 1mg/mL

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), 0.2mg/mL
BNUB2208-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), 0.2mg/mL

Sign In for Pricing
View Details