Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB7 Peptide - middlel region

HOXB7 Peptide - middlel region

Product Specifications

Product Name Alternative

Hox-2.3, AI325018

UniProt

P09024

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_034590.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Leucyl-L-tyrosine
TRC-L330183-50MG 50 mg

L-Leucyl-L-tyrosine

Sign In for Pricing
View Details
NRG1 Human Gene Knockout Kit (CRISPR)
KN211372LP 1 Kit

NRG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SSX2 (C-term) Rabbit Polyclonal Antibody
AP23257PU-N 100 µg

SSX2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Nutlin-3
SIH-344-25MG 25 mg

Nutlin-3

Sign In for Pricing
View Details
Pass Box BSPB-102
BSPB-102 1 Unit

Pass Box BSPB-102

Sign In for Pricing
View Details
FPRL1 (FPR2) (C-term) Mouse Monoclonal Antibody [Clone ID: B4D9B10]
AM09318PU-N 500 µg

FPRL1 (FPR2) (C-term) Mouse Monoclonal Antibody [Clone ID: B4D9B10]

Sign In for Pricing
View Details