Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM28 Peptide - middle region

TRIM28 Peptide - middle region

Product Specifications

Product Name Alternative

KAP-1, Tif1b, KRIP-1, MommeD9, AA408787, Tif1beta

UniProt

Q62318

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035718.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEAFGKIVAERPGTNSTGPGPMAPPRAPGPLSKQGSGSSQPMEVQEGYGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
CF805221 100 µg

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI2G1]

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_001135701) Human Over-expression Lysate
LY427675 100 µg

14-3-3 zeta (YWHAZ) (NM_001135701) Human Over-expression Lysate

Sign In for Pricing
View Details
DNMT3L Human Gene Knockout Kit (CRISPR)
KN400187 1 Kit

DNMT3L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bulk anti-Human CXCR4 (12G5) Antibody
ICH1199-100mg 100 mg

Bulk anti-Human CXCR4 (12G5) Antibody

Sign In for Pricing
View Details
HMGCS1 Antibody
KC-47535-01 50 μL

HMGCS1 Antibody

Sign In for Pricing
View Details
HMGCS1 Antibody
KC-47535-02 100 µL

HMGCS1 Antibody

Sign In for Pricing
View Details