Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPSM2 Peptide - middle region

GPSM2 Peptide - middle region

Product Specifications

Product Name Alternative

LGN, Pins, 6230410J09Rik

UniProt

Q8VDU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_083798.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APSVSVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTKGNSPSVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP7A1 Rabbit Polyclonal Antibody
TA360756 100 µL

CYP7A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Canine Neurophysin-1 ELISpot
SPOT2384D 1 Set

Canine Neurophysin-1 ELISpot

Sign In for Pricing
View Details
CD69 Mouse Monoclonal Antibody
AMM80829-01 1 Each

CD69 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD69 Mouse Monoclonal Antibody
AMM80829-02 50 µL

CD69 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD69 Mouse Monoclonal Antibody
AMM80829-03 100 µL

CD69 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD147 Antibody
ABF5221 100 µg

CD147 Antibody

Sign In for Pricing
View Details