Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX2 Peptide - C-terminal region

PRDX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TR, PRP, TPx, TSA, TDX1, NkefB, PrxII, TPx-B, Tdpx1, Torin, Band-8, AL022839

UniProt

Q61171

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001304314.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]
TA500020BM 100 µL

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
Human Semenogelin II (SEMG2) ELISA Kit
RD-SEMG2-Hu-01 96 Tests

Human Semenogelin II (SEMG2) ELISA Kit

Sign In for Pricing
View Details
Human Semenogelin II (SEMG2) ELISA Kit
RD-SEMG2-Hu-02 48 Tests

Human Semenogelin II (SEMG2) ELISA Kit

Sign In for Pricing
View Details
Glucagon Recombinant Rabbit Monoclonal Antibody [JF0960]
ET1702-20 100 µL

Glucagon Recombinant Rabbit Monoclonal Antibody [JF0960]

Sign In for Pricing
View Details
Amplite® Fluorimetric Acidic Sphingomyelinase Assay Kit *Red Fluorescence*
13622-AAT 200 Tests

Amplite® Fluorimetric Acidic Sphingomyelinase Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
Human RLTPR (CARMIL2) activation kit by CRISPRa
GA115548 1 Kit

Human RLTPR (CARMIL2) activation kit by CRISPRa

Sign In for Pricing
View Details