Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX10 Peptide - C-terminal region

DDX10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HRH-J8

UniProt

Q13206

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX10 Rabbit Polyclonal Antibody (orb575931) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004389

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP102 (DLG3) Mouse Monoclonal Antibody [Clone ID: OTI5F1]
TA502191 100 µL

SAP102 (DLG3) Mouse Monoclonal Antibody [Clone ID: OTI5F1]

Sign In for Pricing
View Details
SLC6A1 peptide
orb382335-01 1 mg

SLC6A1 peptide

Sign In for Pricing
View Details
SLC6A1 peptide
orb382335-02 5 mg

SLC6A1 peptide

Sign In for Pricing
View Details
PHA 767491 Dihydrochloride Salt
sc-478511 25 mg

PHA 767491 Dihydrochloride Salt

Sign In for Pricing
View Details
Pyropheophorbide-a
sc-264178A 50 mg

Pyropheophorbide-a

Sign In for Pricing
View Details
Cetirizine Impurity C
HY-131256 1 Each

Cetirizine Impurity C

Sign In for Pricing
View Details