Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Forkhead box protein C1 (FOXC1)

This Recombinant Human Forkhead box protein C1 (FOXC1) spans the amino acid sequence from region 1-553aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Forkhead-related protein FKHL7; Forkhead-related transcription factor 3; FREAC-3

UniProt

Q12948

Expression Region

1-553aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENG Peptide
MBS3226333-01 0.1 mg

ENG Peptide

Sign In for Pricing
View Details
ENG Peptide
MBS3226333-02 5x 0.1 mg

ENG Peptide

Sign In for Pricing
View Details
Glycolithocholic Acid-3-O-β-glucuronide Disodium Salt
451357-01 1 mg

Glycolithocholic Acid-3-O-β-glucuronide Disodium Salt

Sign In for Pricing
View Details
Glycolithocholic Acid-3-O-β-glucuronide Disodium Salt
451357-02 5 mg

Glycolithocholic Acid-3-O-β-glucuronide Disodium Salt

Sign In for Pricing
View Details
Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: LBI3C6]
AMM12447VCF 100 µg

Phosphoribosyl pyrophosphate amidotransferase (PPAT) Mouse Monoclonal Antibody [Clone ID: LBI3C6]

Sign In for Pricing
View Details
Recombinant Pyrobaculum aerophilum Argininosuccinate lyase (argH)
MBS1458352-01 0.02 mg (E-Coli)

Recombinant Pyrobaculum aerophilum Argininosuccinate lyase (argH)

Sign In for Pricing
View Details