Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Interferon gamma (IFNG)

This Recombinant Dog Interferon gamma (IFNG) spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma

UniProt

P42161

Expression Region

24-166aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Stomach
CS509706 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559406 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-01 20 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-02 100 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-03 500 µg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Merlin/NF2 protein (His Tag)
PDEH100698-04 1 mg

Recombinant Human Merlin/NF2 protein (His Tag)

Sign In for Pricing
View Details