Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal pentraxin-1 (NPTX1), partial

This Recombinant Human Neuronal pentraxin-1 (NPTX1), partial spans the amino acid sequence from region 88-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NP1) (Neuronal pentraxin I) (NP-I)

UniProt

Q15818

Expression Region

88-227aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPTBN2 Human Recombinant Protein
TP724970 50 µg

SPTBN2 Human Recombinant Protein

Sign In for Pricing
View Details
NT-3 Recombinant Protein
M10-232 10 µg

NT-3 Recombinant Protein

Sign In for Pricing
View Details
CNBP 293 Cell Lysate
408735 0.1 mg

CNBP 293 Cell Lysate

Sign In for Pricing
View Details
C14orf68 (SLC25A47) (NM_207117) Human Tagged ORF Clone Lentiviral Particle
RC221734L1V 200 µL

C14orf68 (SLC25A47) (NM_207117) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Nestin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0008R-BF680-01 20 µL

Nestin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Nestin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0008R-BF680-02 100 µL

Nestin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details