Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma receptor 1 (IFNGR1), partial

This Recombinant Human Interferon gamma receptor 1 (IFNGR1), partial spans the amino acid sequence from region 18-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-gamma receptor 1) (IFN-gamma-R1) (CDw119) (Interferon gamma receptor alpha-chain) (IFN-gamma-R-alpha) (CD antigen CD119)

UniProt

P15260

Expression Region

18-245aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C16orf48 (ENKD1) activation kit by CRISPRa
GA113364 1 Kit

Human C16orf48 (ENKD1) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS801451 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
Human LRRK2 (G2019S) Protein, His Tag
LK2-H5245-20ug 20 µg

Human LRRK2 (G2019S) Protein, His Tag

Sign In for Pricing
View Details
MHC Class II I-Ap Mouse Monoclonal Antibody [Clone ID: 7-16.17]
CL072 1 mL

MHC Class II I-Ap Mouse Monoclonal Antibody [Clone ID: 7-16.17]

Sign In for Pricing
View Details
TTNPB
SIH-608-25MG 25 mg

TTNPB

Sign In for Pricing
View Details
SERTAD1 Rabbit Polyclonal Antibody
TA371502 100 µL

SERTAD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details