Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) (Active)
This Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) spans the amino acid sequence from region 27-282aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Insulin-like growth factor-binding protein 7; IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor (TAF) ; IGFBP7; MAC25, PSF
UniProt
Q16270
Expression Region
27-282aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research; Stem Cell & Developmental Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD93 at 2 μg/mL can bind Human IGFBP7. The EC50 is 3.405-5.456 ng/mL.
Form
Lyophilized powder
Molecular Weight
55.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NB110-41568AF532 0.1 mL
Rabbit Polyclonal LOX propeptide Antibody [Alexa Fluor 532]
Sign In for Pricing
View Details 
MBS1181595-01 0.02 mg (E-Coli)
Recombinant Human Chondroadherin (CHAD)
Sign In for Pricing
View Details MBS1181595-02 0.02 mg (Yeast)
Recombinant Human Chondroadherin (CHAD)
Sign In for Pricing
View Details